PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.090630.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 259aa    MW: 29879.9 Da    PI: 5.268
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.090630.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-091872212155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp++ee+ +L+  +gL+++q+ +WF N+R ++
  Cucsa.090630.3 187 KWPYPTEEEKSKLSVTTGLDQKQINNWFINQRKRH 221
                     569*****************************885 PP

2ELK35.22.8e-12141162122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     +LK++Ll+KYsgyL+sLk+EF+
  Cucsa.090630.3 141 DLKEMLLKKYSGYLSSLKKEFL 162
                     6********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037901.8E-41838IPR005540KNOX1
SMARTSM012561.8E-214293IPR005541KNOX2
PfamPF037915.9E-214692IPR005541KNOX2
PfamPF037892.0E-9141162IPR005539ELK domain
PROSITE profilePS5121310.947141161IPR005539ELK domain
SMARTSM011885.9E-6141162IPR005539ELK domain
PROSITE profilePS5007112.503161224IPR001356Homeobox domain
SuperFamilySSF466891.54E-18163233IPR009057Homeodomain-like
SMARTSM003891.5E-11163228IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-25166224IPR009057Homeodomain-like
CDDcd000863.22E-12173224No hitNo description
PfamPF059203.0E-17181220IPR008422Homeobox KN domain
PROSITE patternPS000270199222IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MCLGAFEVVT FFNVDVFFKV GAPPQVASLL EEIGRENHPS RSSIELGADP QLDNFMESYC  60
EVLHQYKNEL SKPFDEATMF LTNIELELSN LCKGSFTMMS DSRSAMNDEV SGTPEEEPSS  120
YEEVEMPRNH EPFCIRKTNQ DLKEMLLKKY SGYLSSLKKE FLKKRKKEKL PKDARMALLD  180
WWNTHYKWPY PTEEEKSKLS VTTGLDQKQI NNWFINQRKR HWKPPEDMRF VLMDGVGAGE  240
CMKGSNFYDN GETGSHVI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156165LKKEFLKKRK
2162166KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818471e-129LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132591e-129LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144749.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-78KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0A0LGZ60.0A0A0A0LGZ6_CUCSA; Uncharacterized protein
STRINGVIT_14s0060g01180.t012e-99(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-59KNOTTED1-like homeobox gene 6